PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27703.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 271aa    MW: 30177.5 Da    PI: 5.3813
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27703.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.16.1e-11149206562
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 k ++r+++NRe+A rs  +K +++  L ++ ++L a+N +L+ + ++l+  +++l+++
  KFK27703.1 149 KDAKRMISNRESAARSKMKKAQQLFDLNTENATLRAQNNQLQANYNQLQSDYSALENQ 206
                 789**************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-11145209IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634147210IPR004827Basic-leucine zipper domain
PfamPF001703.2E-8149206IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-10149207No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-9149207No hitNo description
CDDcd147022.52E-12152201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MSQPSSTSFL PVLGPSTFGD SRATPSLLPT WNPTWNHRTP GDIAMVGVES NEDQLVSQYM  60
NMDNNEAALE GNENVGDGIG RRPGKEIAGS GSHSRNVSVD CYGDGKSSTG VVSTNPPNSS  120
VNSRLFTDNE MKMIMADEKL KKLAITSPKD AKRMISNRES AARSKMKKAQ QLFDLNTENA  180
TLRAQNNQLQ ANYNQLQSDY SALENQMREM MIHNQGLLET GRIKDELIEQ HRRDSEGMSM  240
QLQQLQQLQS LDMVQQLNTN HLRNQDFDGN I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161169ARSKMKKAQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A087GCV10.0A0A087GCV1_ARAAL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.12e-14bZIP family protein